DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Tpsb2

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:277 Identity:87/277 - (31%)
Similarity:129/277 - (46%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLP-----VQSAPGKLNGRV--VGGEDAVKNQFPHQVSLRNAGS---HSCGGSILTR 64
            :...||.|.|.     |.:||..:..||  |||.:|.::::|.|||||...|   |.||||::..
  Rat     1 MLKLLLLLALSPLASLVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHP 65

  Fly    65 TYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN--DVAL 127
            .::|||||||.    .|:.:|   |.|.::......:....|:.|...:||..|....:  |:||
  Rat    66 QWVLTAAHCVG----LHIKSP---ELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIAL 123

  Fly   128 LRLESPLILSASIQPIDLPTVDT--PADVDVVISGWGRI-KHQGDLPRY-LQYNTLKSITRQQCE 188
            |.||:|:.:|..|.|..||....  |:.....::|||.| ..:..||.| |:...:..:....|:
  Rat   124 LELENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCD 188

  Fly   189 ELIDFGF----------EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVV---DGCG-STY 239
            .....|.          :|.|| .....:.:|.||||||.|...:...:...||   :||. :..
  Rat   189 RKYHTGLYTGDDVPIVQDGMLC-AGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANR 252

  Fly   240 PDGYARVFYFKDWIKKH 256
            |..|.||.|:.|||.::
  Rat   253 PGIYTRVTYYLDWIHRY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 78/246 (32%)
Tryp_SPc 32..256 CDD:238113 79/248 (32%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 78/245 (32%)
Tryp_SPc 30..266 CDD:214473 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.