DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss38

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:133/278 - (47%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLC----SFLLFLVLPVQSAPGK--LNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTY 66
            :|.|    |..|||    .||.|:  |:|:::|||..:..::|.|||:..||.|.||||||...:
  Rat    88 LLWCGREPSLHLFL----SSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYW 148

  Fly    67 ILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVA----------EVIVHEEYGNF 121
            :||||||.:.|.               |..:.|.:.|...::||          :||:|..:..|
  Rat   149 VLTAAHCFAREK---------------RLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMF 198

  Fly   122 L---NDVALLRLESPLILSASIQPIDLPTVD-TPADVDVVISGWGRIKHQGDLPRYLQYNTLKSI 182
            .   .||||::.:|.::.|..:.||.||:.: ..:|:....:|||.:..||:..:.|....|..|
  Rat   199 HPVGGDVALVQSKSAIVFSDYVLPICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLI 263

  Fly   183 TRQQCEELIDFGFEG----ELCLLHQVDN--GACNGDSGGPAVYN-NQL---VGVAGFVVDGCGS 237
            .:.||:.|  :|...    |:.....:.|  ..|.||||.|.|.. ||.   :|:..: ..||..
  Rat   264 PKFQCQLL--YGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSW-GRGCAQ 325

  Fly   238 -TYPDGYARVFYFKDWIK 254
             .||..:|.|.||.:||:
  Rat   326 PLYPGVFANVSYFLNWIR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 75/246 (30%)
Tryp_SPc 32..256 CDD:238113 77/248 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 76/244 (31%)
Tryp_SPc 116..342 CDD:214473 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.