DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss29

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:132/278 - (47%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGK-----LNGRVVGGEDAVKNQFPHQVSLR----NAGS--HSCGGSILTRTYI 67
            |:||...:...|..     |.| :|||..|.:.::|.|||||    |..|  |.|||||:...::
  Rat     9 LIFLGSSIAGIPASVPEDVLVG-IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWV 72

  Fly    68 LTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRL 130
            ||||||:...|.:    |.|   |.|..|....:.|..|::|:.||:|.::  ....:|||||:|
  Rat    73 LTAAHCIHESDAD----PSA---FRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQL 130

  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVV------ISGWGRIK-HQGDLPRY-LQYNTLKSITRQQC 187
            ...:....:::|:.|    :||.::|.      ::|||.:. |:...|.| ||...:|.:....|
  Rat   131 AQSVRSFPNVKPVKL----SPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLC 191

  Fly   188 EEL----IDFGFEGELCLLHQV------DNGACNGDSGGPAVYNN----QLVGVA--GFVVDGCG 236
            |:|    ......|:..:|..:      ...:|.||||||.|.|.    .||||.  |:   ||.
  Rat   192 EKLYRNATRLSNHGQRLILQDMLCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGY---GCA 253

  Fly   237 -STYPDGYARVFYFKDWI 253
             ...|..||||.:|..||
  Rat   254 LKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 83/254 (33%)
Tryp_SPc 32..256 CDD:238113 85/255 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.