DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and LOC286960

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:264 Identity:70/264 - (26%)
Similarity:121/264 - (45%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |::|........:.|||..     :.::|||....|:..|:||||.:..||.||||:::..::|:
  Rat     2 KISIFFAFLGAAVALPVND-----DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLS 61

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRF---SGGVLVQVAEVIVHEEYG--NFLNDVALLR 129
            ||||..             .:..:|.|.::..   .|...:...::|.|.||.  ...||:.|::
  Rat    62 AAHCYK-------------RKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIK 113

  Fly   130 LESPLILSASIQPIDLPTVDTPADVDVVISGWGR-IKHQGDLPRYLQYNTLKSITRQQCEELIDF 193
            |:||.:|::.:..:.||......|...::||||. :...|..|..||......::...|::....
  Rat   114 LKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPG 178

  Fly   194 GFEGELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCGST-----YPDGYARVFYFKD 251
            .....:..|..::.|  :|:||||||.|.|.::.|:..:     ||.     .|..|.:|..:..
  Rat   179 QITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSW-----GSVCAMRGKPGVYTKVCNYLS 238

  Fly   252 WIKK 255
            ||::
  Rat   239 WIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/234 (27%)
Tryp_SPc 32..256 CDD:238113 65/237 (27%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 63/234 (27%)
Tryp_SPc 24..243 CDD:238113 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.