DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and KLK9

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:264 Identity:71/264 - (26%)
Similarity:112/264 - (42%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC 73
            |||:.|..|     :..|..:.|.:|.|:...|..|.|..|.:.....||.::::..::||||||
Human     5 LLCALLSLL-----AGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHC 64

  Fly    74 VSNEDVNHVITPIAAERFTIRAGSND--RFSG-GVLVQVAEVIVHEEYGNFL------NDVALLR 129
                         ......:|.|.:.  ::.| ..|.:|.:...|..:...|      :|:.|:|
Human    65 -------------RKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIR 116

  Fly   130 LESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDL-PRYLQYNTLKSITRQQCEELIDF 193
            |.....||.::||::|........:..:|||||.:.....| |..||...:..:..:.|.    :
Human   117 LPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCH----W 177

  Fly   194 GFEGE-----LCL-LHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKD 251
            .:.|.     ||. |.:...|:|.||||||.|.|..|.||.....:.|. ...|..|..|.::.|
Human   178 AYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLD 242

  Fly   252 WIKK 255
            ||::
Human   243 WIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/238 (26%)
Tryp_SPc 32..256 CDD:238113 64/241 (27%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.