DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and TPSG1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:252 Identity:77/252 - (30%)
Similarity:110/252 - (43%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIR 94
            ||:|||..|....:|.|.|||....|.||||:|:..::||||||.|..        :.:..:.:.
Human    61 GRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGS--------LNSSDYQVH 117

  Fly    95 AGS-----NDRFSGGVLVQVAEVIVHEE---YGNFLNDVALLRLESPLILSASIQPIDLPTV--D 149
            .|.     :..||     .|.::|:|..   ......|:||:.|..|:.||:.|.|:.||..  |
Human   118 LGELEITLSPHFS-----TVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDD 177

  Fly   150 TPADVDVVISGWGRIKHQGDLPRYLQYNTLK--SITRQQCEELIDFGFEG-------ELCLLHQV 205
            ....:...::|||..:....||.......:|  .:..:.|..  |:...|       .||.....
Human   178 FCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRR--DYPGPGGSILQPDMLCARGPG 240

  Fly   206 DNGACNGDSGGPAVYNNQLVGV---AGFVV--DGCG-STYPDGYARVFYFKDWIKKH 256
            |  ||..|||||.|.  |:.|.   ||.|.  :||| ...|..|.||..:.:||::|
Human   241 D--ACQDDSGGPLVC--QVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 73/246 (30%)
Tryp_SPc 32..256 CDD:238113 74/248 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 73/246 (30%)
Tryp_SPc 63..293 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.