DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:265 Identity:81/265 - (30%)
Similarity:126/265 - (47%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED 78
            :|.||....:.|.:.:.::|||....::..|:|||| |:|.|.||||::...::::||||..:  
  Rat     6 ILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKS-- 67

  Fly    79 VNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESP 133
                       |..:|.|        .:::|     :..|::|.|..|.::.  ||:.|::|.||
  Rat    68 -----------RIQVRLGEHNINVLEGDEQF-----INAAKIIKHPNYSSWTLNNDIMLIKLSSP 116

  Fly   134 LILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCE--------- 188
            :.|:|.:.|:.||:...||....:|||||.....| :.|..||......:::..||         
  Rat   117 VKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITS 181

  Fly   189 ELIDFGF-EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG---YARVFYF 249
            .:|..|| ||        ...:|.||||||.|.|.||.|:..:   |.|...||.   |.:|..|
  Rat   182 SMICVGFLEG--------GKDSCQGDSGGPVVCNGQLQGIVSW---GYGCALPDNPGVYTKVCNF 235

  Fly   250 KDWIK 254
            ..||:
  Rat   236 VGWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 75/245 (31%)
Tryp_SPc 32..256 CDD:238113 77/247 (31%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 75/245 (31%)
Tryp_SPc 24..242 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.