DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Try4

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:124/272 - (45%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVL-------PVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAA 71
            ||||.|       ||..     :.::|||....:|..|:|||| |:|.|.||||::...::::||
Mouse     4 LLFLALVGAAVAFPVDD-----DDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVSAA 62

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYGN--FLNDVA 126
            ||..:             |..:|.|        .|::|     |..|::|.|..:.:  ..||:.
Mouse    63 HCYKS-------------RIQVRLGEHNINVLEGNEQF-----VNSAKIIKHPNFNSRTLNNDIM 109

  Fly   127 LLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCE-- 188
            |::|.||:.|:|.:..:.||:...||....:|||||.....| :.|..||......:.:..||  
Mouse   110 LIKLASPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEAS 174

  Fly   189 -------ELIDFGF-EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDG 242
                   .:|..|| ||        ...:|.||||||.|.|.||.|:.  |:   ||. ...|..
Mouse   175 YPGKITNNMICVGFLEG--------GKDSCQGDSGGPVVCNGQLQGIVSWGY---GCALKDNPGV 228

  Fly   243 YARVFYFKDWIK 254
            |.:|..:.|||:
Mouse   229 YTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/245 (31%)
Tryp_SPc 32..256 CDD:238113 78/247 (32%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 76/245 (31%)
Tryp_SPc 24..242 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.