DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk1

DIOPT Version :10

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_034769.4 Gene:Klk1 / 16612 MGIID:102850 Length:261 Species:Mus musculus


Alignment Length:74 Identity:22/74 - (29%)
Similarity:33/74 - (44%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 STTDIPLYTETYTK--DWWY----AKRDEAVK-ESGFPEASGTIGYTMLYDR-KTCSASTECLFT 91
            ||.:..|.||....  |.:|    .:||.:|: ...|.|||..: :.:|..| |..:.:|.....
Mouse   143 STGEASLLTEAELMGLDEFYKLIGPERDSSVRLAEQFDEASVHL-WELLEGRDKAVAGTTYKALK 206

  Fly    92 STGDKSRIS 100
            .|.||..:|
Mouse   207 ETLDKMLLS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 32..256 CDD:238113 22/74 (30%)
Klk1NP_034769.4 Tryp_SPc 24..253 CDD:214473 22/74 (30%)

Return to query results.
Submit another query.