DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Gzmk

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:272 Identity:62/272 - (22%)
Similarity:112/272 - (41%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED 78
            |:.||..|..:....:..::||.:...:..|...|::....|.|||.::...::||||||.|...
Mouse     8 LVSLVAGVYMSSECFHTEIIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFP 72

  Fly    79 VNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEV-----IVHEEYGNFLNDVALLRLESPLILSA 138
            ..|  :|      |:..|::.......:.|..|:     ....:.|:..:|:.|::|.:...|:.
Mouse    73 RGH--SP------TVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNK 129

  Fly   139 SIQPIDLPTVDTPAD-VDVVISGWGRIKHQGDLPRYL-QYNTLKSIT-----RQQC--------- 187
            ::|.:.|.:.:...| ....::|||..|     |..| ..:||:.:|     |::|         
Mouse   130 NVQLLHLGSKNYLRDGTKCQVTGWGTTK-----PDLLTASDTLREVTVTIISRKRCNSQSYYNHK 189

  Fly   188 ----EELIDFG-FEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVD---GCGSTYPDGYA 244
                :::|..| ..|:        ..:|.||||||.:..    |:...:|.   .||.....|..
Mouse   190 PVITKDMICAGDARGQ--------KDSCKGDSGGPLICK----GIFHALVSQGYKCGIAKKPGIY 242

  Fly   245 RVF--YFKDWIK 254
            .:.  .::.|||
Mouse   243 TLLTKKYQTWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 55/252 (22%)
Tryp_SPc 32..256 CDD:238113 58/254 (23%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 55/252 (22%)
Tryp_SPc 26..256 CDD:238113 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.