DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss29

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:282 Identity:95/282 - (33%)
Similarity:132/282 - (46%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLCSFLLFLVLPVQSAP-----GKLNGRVVGGEDAVKNQFPHQVSLR------NAGSHSCGGSI 61
            |.||..|.||...:...|     |.|.| :|||..|.:.::|.|||||      ....|:|||||
Mouse     3 IQLCLTLFFLGCSIAGTPAPGPEGVLMG-IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSI 66

  Fly    62 LTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLND 124
            :...::||||||:...|.:..:       |.||.|....:.|..|:.|:.||:|.::  ....:|
Mouse    67 IHPQWVLTAAHCIRERDADPSV-------FRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSD 124

  Fly   125 VALLRLESPLILSASIQPIDLPTVD---TPADVDVVISGWGRIK-HQGDLPRY-LQYNTLKSITR 184
            ||||:|...:....:::|:.||:..   |..|| ..::|||.:. |:...|.| ||...:|.|..
Mouse   125 VALLQLAVSVQSFPNVKPVKLPSESLEVTKKDV-CWVTGWGAVSTHRSLPPPYRLQQVQVKIIDN 188

  Fly   185 QQCEELIDFG-----------FEGELCLLHQVDNGACNGDSGGPAVYNN----QLVGVA--GFVV 232
            ..|||:....           .:..||..:| ...:|.||||||.|.|.    .||||.  |:  
Mouse   189 SLCEEMYHNATRHRNRGQKLILKDMLCAGNQ-GQDSCYGDSGGPLVCNVTGSWTLVGVVSWGY-- 250

  Fly   233 DGCG-STYPDGYARVFYFKDWI 253
             ||. ..:|..||||..|..||
Mouse   251 -GCALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 83/252 (33%)
Tryp_SPc 32..256 CDD:238113 85/253 (34%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 85/253 (34%)
Tryp_SPc 31..271 CDD:214473 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.