DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss28

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:255 Identity:77/255 - (30%)
Similarity:123/255 - (48%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVGGEDAVKNQFPHQVSLR------NAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAER 90
            :|||:.....::|.|||||      |:..|.|||||:...:|||||||:.::|.:..:       
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAV------- 88

  Fly    91 FTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN--DVALLRLESPLILSASIQPIDLP----TVD 149
            :.::.|....:....|:.::.:|:|.:|.:...  |:||::|.:.|:.|.::.|:.||    |.|
Mouse    89 YRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFD 153

  Fly   150 TPADVDVVISGWGRIKHQGDL-PRY--------LQYNTLKSITRQQCEELIDFG-----FEGELC 200
            :.....:|  |||.:..:..| |.|        :|.|  ||..|...::..|..     |:..||
Mouse   154 STDQCWLV--GWGNLLQRVPLQPPYQLHEVKIPIQDN--KSCKRAYRKKSSDEHKAVAIFDDMLC 214

  Fly   201 LLHQVDNGACNGDSGGPAV--YNNQLVGVAGFVVDG--CGSTYPDGYARVFYFKDWIKKH 256
             ......|.|.||||||.|  .:|:.:.| |.|..|  |.:..|..::||.....||.:|
Mouse   215 -AGTSGRGPCFGDSGGPLVCWKSNKWIQV-GVVSKGIDCSNNLPSIFSRVQSSLAWIHQH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/250 (30%)
Tryp_SPc 32..256 CDD:238113 76/253 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 76/253 (30%)
Tryp_SPc 31..269 CDD:214473 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.