DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and KLK11

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:273 Identity:75/273 - (27%)
Similarity:123/273 - (45%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNG--RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC--- 73
            |:.|.|    |.|.:.|  |::.|.:...:..|.|.:|.......||.:::...::||||||   
Human    38 LILLAL----ATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKP 98

  Fly    74 -VSNEDVNHVITPIAA--------ERFTIRAGSND--RFSGGVLVQVA-EVIVHEEYGNFL---- 122
             ||.....||...:::        .|:.:..|.::  :..|....:.| |...|..:.|.|    
Human    99 WVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKD 163

  Fly   123 --NDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKH-QGDLPRYLQYNTLKSITR 184
              ||:.|:::.||:.::.:::|:.|.:....|....:|||||.... |..||..|:...:..|..
Human   164 HRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEH 228

  Fly   185 QQCEELIDFGFEGEL---CLLHQVDNG---ACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG- 242
            |:||.    .:.|.:   .:...|..|   :|.||||||.|.|..|.|:..:..|.|..|...| 
Human   229 QKCEN----AYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGV 289

  Fly   243 YARVFYFKDWIKK 255
            |.:|..:.|||::
Human   290 YTKVCKYVDWIQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 67/250 (27%)
Tryp_SPc 32..256 CDD:238113 68/253 (27%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 67/250 (27%)
Tryp_SPc 54..303 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.