DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:250 Identity:70/250 - (28%)
Similarity:118/250 - (47%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHV 82
            ::||.|:.|     .|||:::....:|.|.||......:||||::.:.::|:||||.:.:.....
Zfish   299 IIPVNSSNG-----TVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFY 358

  Fly    83 ITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN---FLNDVALLRLESPLILSASIQPID 144
            :|.|...:      :.:::....:.:..:.::...|.|   ..||:||:||..|:..:.||:|:.
Zfish   359 LTVILGPK------TQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVC 417

  Fly   145 LPTVDT--PADVDVVISGWGRIKHQGDL--PRYLQYNTLKSITRQQCEELIDFG--FEGELCL-L 202
            |....:  .:|.:..|:.|..|.....|  |:..|...:..|..:||..|...|  .:..:|. |
Zfish   418 LAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGL 482

  Fly   203 HQVDNGACNGDSGGPAVYNNQLVGVAGFVV---DGCG-STYPDGYARVFYFKDWI 253
            .:.....|.||||||.|.|...|.|...:|   .||. |.:|..|.||..:::||
Zfish   483 LKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 64/235 (27%)
Tryp_SPc 32..256 CDD:238113 65/235 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.