DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and LOC100498532

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:261 Identity:66/261 - (25%)
Similarity:113/261 - (43%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED 78
            |:||.:...:.....:.::|||.:...:..|.||.....|.:.||||:::..:|::||||.  :.
 Frog     7 LMFLAVAAAAPLDDDDDKIVGGYECTPHSQPWQVLFTYNGGNWCGGSLISPRWIISAAHCY--QP 69

  Fly    79 VNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQ 141
            ...::..:.......:.|:...      :||.....|..|.:..  :|:.|::|..|...:..:|
 Frog    70 PKTLVALLGEHDLKKKEGTEQH------IQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQYVQ 128

  Fly   142 PIDLPTVDTPAD-VDVVISGWGRI-KHQGDLPRYLQYNTLKSITRQQC---------EELIDFGF 195
            ||.:.. ..|.| ...::||:|.: .:....|..||...:..::...|         |.:...||
 Frog   129 PIPVAR-SCPTDGAKCLVSGFGNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRMISENMFCAGF 192

  Fly   196 -EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTY------PDGYARVFYFKDWI 253
             ||        ..|:|:||||||.:.|.:|.|...:     |.:|      |..||:|..:.|||
 Frog   193 LEG--------GKGSCHGDSGGPLICNGELYGAVSW-----GGSYCISKNSPGVYAKVCNYLDWI 244

  Fly   254 K 254
            |
 Frog   245 K 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 60/241 (25%)
Tryp_SPc 32..256 CDD:238113 63/243 (26%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.