DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and zgc:171509

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:120/250 - (48%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNE 77
            |:|.:.:.|.|...|    ::||.:...:..|.|..| :.|...||||::..:::::||||.|:.
Zfish     6 FILLIGVVVHSKGDK----IIGGHECQPHSQPWQARL-DDGYGLCGGSLIHESWVVSAAHCKSSS 65

  Fly    78 DVNHVITPIAAERFTIRAGSNDRF---SGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLILS 137
            .:.|:             |.:|.|   .....:|..:||.|.:|.|  ..||:.|::|..|.:::
Zfish    66 IIVHL-------------GKHDLFVVEDTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVIN 117

  Fly   138 ASIQPIDLPTVDTPADVDVVISGWGRIKHQGD-LPRYLQYNTLKSITRQQCEELIDFGFEGELCL 201
            .:::|:.|||..:.|....::||||   ..|| :...||...|..:::..|:.........::..
Zfish   118 NNVKPVPLPTNCSHAGEQCLVSGWG---VTGDSISSTLQCLELPILSKADCKSAYGRVITKKMFC 179

  Fly   202 LHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWI 253
            ...:|.|  :|.||||||.|.|..|.|:..|.: ||... :|..|..|..:.:||
Zfish   180 AGFMDGGKDSCQGDSGGPVVCNGTLKGIVSFGI-GCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 64/230 (28%)
Tryp_SPc 32..256 CDD:238113 65/230 (28%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 65/234 (28%)
Tryp_SPc 21..234 CDD:238113 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.