DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and zgc:165423

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:280 Identity:97/280 - (34%)
Similarity:135/280 - (48%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FGKVAILLCSFLLFLV----LPVQSAP--GK--LNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGG 59
            |.|:: |||...|...    .|.||.|  ||  ||.::|||.:|....:|.|.||..:|||.|||
Zfish     2 FWKLS-LLCVVTLLSTGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGG 65

  Fly    60 SILTRTYILTAAHCV-SNEDVNHVITPIAAERFTIRAGSNDR---FSGGVLVQVAEVIVHEEY-- 118
            |:::..:||:||||. ||.:.:.         :|:..|...:   ....|...|::||||..|  
Zfish    66 SLISDQWILSAAHCFPSNPNPSD---------YTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQG 121

  Fly   119 GNFLNDVALLRLESPLILSASIQPIDLPTVDTPADVDVV-ISGWGRIKHQGDL--PRYLQYNTLK 180
            ....||:|||.|.||:..|..|||:.|....:....|.: |:|||.|:....|  |:.||...:.
Zfish   122 STHDNDMALLHLSSPVTFSNYIQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVP 186

  Fly   181 SITRQQCEELIDFG---FEGELCL-LHQVDNGACNGDSGGPAV---YNNQL-VGVAGFVVDGCGS 237
            .:....|..|...|   ....:|. |.|....:|.||||||.|   :|..: .||..| ..||..
Zfish   187 IVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSF-GKGCAD 250

  Fly   238 -TYPDGYARVFYFKDWIKKH 256
             .||..||||..:::||.::
Zfish   251 PNYPGVYARVSQYQNWISQY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 81/239 (34%)
Tryp_SPc 32..256 CDD:238113 83/241 (34%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 81/239 (34%)
Tryp_SPc 38..269 CDD:238113 83/240 (35%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.