DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Gm10334

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:259 Identity:79/259 - (30%)
Similarity:120/259 - (46%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLVLPVQSA----PGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSN 76
            ||:|.:..|    |...:.::|||....:|..|:|||| |:|.|.||||::...::::||||...
Mouse     4 FLILALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKT 67

  Fly    77 EDVNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLE 131
                         |..:|.|        .|::|     |..|::|.|..:.  ...||:.|::|.
Mouse    68 -------------RIQVRLGEHNINVLEGNEQF-----VNAAKIIKHPNFNRKTLNNDIMLIKLS 114

  Fly   132 SPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCEELIDFGF 195
            ||:.|:|.:..:.||:...||....:|||||.....| ..|..||......:.:..||.......
Mouse   115 SPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKI 179

  Fly   196 EGELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG---YARVFYFKDWIK 254
            .|.:.....::.|  :|.||||||.|.|.:|.|:..:   |.|...||.   |.:|..:.|||:
Mouse   180 TGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/237 (30%)
Tryp_SPc 32..256 CDD:238113 74/239 (31%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.