DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and zgc:163079

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:259 Identity:69/259 - (26%)
Similarity:119/259 - (45%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APGKLNGRVVGGEDAVKNQFPHQ--VSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPI 86
            ||  ||.:::||.:|.:..:|.|  ::|:......||||::.:.::||.|...:....:.::..:
Zfish    30 AP--LNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYL 92

  Fly    87 AAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDLPT---- 147
            ..:   .:.|||..   .:...|.::|.|..|.:..:::|||:|.||:..|..|:|:.|..    
Zfish    93 GRQ---TQNGSNPY---EISRTVTKIIKHPNYNSLDSNLALLKLSSPVTFSDYIKPVCLAAAGSV 151

  Fly   148 -VDTPADVDVVISGWGRIKHQGD-----LPRYLQYNTLKSITRQQC---------EELIDFGFEG 197
             ||..|.   .::|||.:.....     ||..||......:...:|         .:|:..|:  
Zfish   152 FVDGTAS---WVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGY-- 211

  Fly   198 ELCLLHQVDNGACNGDSGGPAVYNNQLVGV-AGFVVDG-CG-STYPDGYARVFYFKDWIKKHSD 258
                |::.....|.||.|||.|.....:.: :|.||.| || ..||..|.||..::|||..:::
Zfish   212 ----LNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWISYYTN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/245 (26%)
Tryp_SPc 32..256 CDD:238113 65/247 (26%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 63/245 (26%)
Tryp_SPc 36..267 CDD:238113 64/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.