DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and LOC100004427

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:256 Identity:64/256 - (25%)
Similarity:113/256 - (44%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APGKLNGRVVGGEDAVKNQFPHQVSL--RNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPI 86
            ||  ||.::|||.:|.:..:|.|.|:  ::.|...|.||:::..::||||.|....:|:.|:  |
Zfish    30 AP--LNTKIVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVV--I 90

  Fly    87 AAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDLPT---- 147
            ...|.|.. |||.......::||          :...|:||::|.|.:..:..|:|:.|..    
Zfish    91 YLGRLTTN-GSNPYEIPRTVIQV----------SVTEDIALVQLSSSVTFTDYIRPVCLAAAGSV 144

  Fly   148 -VDTPADVDVVISGWGRIKH------------QGDLPRYLQYNTLKSITRQQCEELIDFGFEGEL 199
             ||   ..:..::|||....            :..:...::.:.:..||  ..:.:|..||    
Zfish   145 FVD---GTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGIT--NLDNVICAGF---- 200

  Fly   200 CLLHQVDNGACNGDSGGPAV--YNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIKKHS 257
              :::.....|..|.|.|.|  ..:|.:.....|...||.. :|..||||..:::||:.::
Zfish   201 --VNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVFTFCGQNGFPTLYARVSEYEEWIRNYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 58/243 (24%)
Tryp_SPc 32..256 CDD:238113 60/245 (24%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 58/243 (24%)
Tryp_SPc 36..257 CDD:238113 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.