DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and gzm3.3

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:263 Identity:75/263 - (28%)
Similarity:129/263 - (49%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCV 74
            ||:|||.|.:   |..|.::..::||:.|..:..|:..|::....|:|||.::...|:||||||:
Zfish     3 LCTFLLLLAI---SLAGGMDSGIIGGKVAKAHSRPYMASIQINKHHTCGGMLIRDDYVLTAAHCL 64

  Fly    75 SNEDV----NHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY-----GNFLNDVALLRL 130
             |..|    .|:...:.|...:....:..|      :||.:.|.|..:     .::..|:.||:|
Zfish    65 -NRGVYSGRGHLEVVLGAHNISKHEQNQQR------IQVKKYIRHPMFQRNKEKDYSYDIMLLKL 122

  Fly   131 ESPLILSASIQPIDLPTVD--TPADVDVVISGWGRIKHQGDLPR-YLQYNTLKSITRQQCEELID 192
            ::...:|..::.|.||..:  .||:|...::|||..|.:.:|.. .|:..|||.....:|:.:..
Zfish   123 KNKAKISKFVKVISLPKKNGKIPANVKCSVAGWGLTKPKAELASDVLEEVTLKLQFDFECKTMWQ 187

  Fly   193 --FGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDG-C-GSTYPDGYARVFYFKDWI 253
              |..|..:|.:....:..|.||||||.:.|.:...:..:..:| | ...||..:.::.||..||
Zfish   188 QHFNTERMICSVSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGNCINKQYPQVFLKISYFLPWI 252

  Fly   254 KKH 256
            ||:
Zfish   253 KKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/237 (27%)
Tryp_SPc 32..256 CDD:238113 66/239 (28%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 66/239 (28%)
Tryp_SPc 22..252 CDD:214473 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.