DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc1b and SCAP

DIOPT Version :9

Sequence 1:NP_608417.2 Gene:Npc1b / 33072 FlyBaseID:FBgn0261675 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_788277.1 Gene:SCAP / 35529 FlyBaseID:FBgn0033052 Length:1276 Species:Drosophila melanogaster


Alignment Length:561 Identity:117/561 - (20%)
Similarity:215/561 - (38%) Gaps:122/561 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GAFGKTSAPSVCMPTLFGEFFY-HGFRIWGTFCAKHPVIVLALCSWAIAGLSFGIRYM----TIT 349
            |..|...|.|..:|.....|:| ||.     |.:.:|....::...||....:.:..:    ||.
  Fly    43 GVAGAAGASSTGLPASVSHFYYKHGL-----FLSSYPTCASSIAFMAILLSCYPLINIPLPGTIP 102

  Fly   350 TD---PVELWAGE--------ESQTRIEKDYFDQHFGPFYRTNQMFVKAVNQTYFTHETSNGVLN 403
            |.   |.|..:|.        .|.|..|.....:.:.|        ...|..:..|..:...:|.
  Fly   103 TKIVVPYETGSGSLSWHSLNTSSTTPQEPHPSGEPWPP--------EPQVLNSSTTDRSPPPLLP 159

  Fly   404 F---GPAFEY---------------------NF---LKEVFELQDSIMKLGMADNE-GLDKIC-Y 439
            :   .|||.|                     .|   |.|||:|.:.:.....::|: .|:..| :
  Fly   160 WAQSSPAFFYVQQITLRTSVLPWTEGMQLMDAFRAPLHEVFKLLEIVRNHQSSENKRTLEHNCLH 224

  Fly   440 APVLMAGETPTVDR------CAIQSVYGYFQHDMDRFE------NSYVDSNNYTINYLNQLEDCL 492
            ...:..|....:|:      |.:.|....:..:...|.      |:....:|...:.::..|...
  Fly   225 VDNVKRGTHGQLDQIFPEYGCLLLSPANLWTQNSQNFTRDTNILNTIFQYHNLQKSKVSAAEMLF 289

  Fly   493 RVPMMEDCFGTFGGPIEPGIAVGGMPKVAVGEDPDYMLATGLVLTFLGRNYNDESKLEPNMKWEK 557
            .:||.:..|..:             |..|......|.|...|       .:||...|: .:| ||
  Fly   290 GLPMQDTGFKRY-------------PLRARSRIIQYALTLFL-------KHNDMEYLD-TLK-EK 332

  Fly   558 LFVDFLRDYKSDRLDIAYMAERSIQDAIV---ELSEGEVSTVVISYVVMFVYVAIALGHIRSCRG 619
            |    ||.|....|..|...|.:....|.   |....|:....::::::|.||..::..|...| 
  Fly   333 L----LRHYPPLPLASASAEEPTTITYIFYPGEYRMWELVPYTVAFMLVFAYVYFSVRKIDVFR- 392

  Fly   620 FLRESRIMLAIGGIVIVLASVVCSLGFWGYLDVTTTMLAIEVIPFLVLAVGVDNIFIMVHTYQRL 684
                ||.:||:..::....|:..|||...:..:|.::.:.::.|:||:.||::|..::..:...:
  Fly   393 ----SRFLLALCSVITTAGSLAMSLGLCFFFGLTISLQSKDIFPYLVILVGLENSLVITKSVVSM 453

  Fly   685 DHS---KFKTTHEAIGEAIGQVGPSILQTAGSEMACFAIGCISDMPAVKTFAMYAAIAILLDFLL 746
            |.:   |.:     :.:|:.:.|..|.:|..:|:....||..:.:|.::.|.::|.:.:|.||:|
  Fly   454 DETFDVKIR-----VAQALSKEGWHISKTLLTEITILTIGLATFVPVIQEFCIFAIVGLLSDFML 513

  Fly   747 QITAFVALMAIDEKR--------YLDGRLDMLCCVKSGGKK 779
            |:..|..::|::.||        :|...|  |.|.:..|::
  Fly   514 QMLLFSTILAMNIKRTEYTAEAKHLPKML--LSCTQGAGRQ 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc1bNP_608417.2 2A060601 24..1220 CDD:273337 117/561 (21%)
NPC1_N 24..270 CDD:293023
nitrilase <265..>331 CDD:299711 11/41 (27%)
Sterol-sensing 623..775 CDD:289145 40/162 (25%)
SCAPNP_788277.1 Sterol-sensing 390..542 CDD:289145 38/161 (24%)
WD40 <878..1227 CDD:225201
WD40 878..1185 CDD:295369
WD40 repeat 887..942 CDD:293791
WD40 repeat 945..983 CDD:293791
WD40 repeat 989..1070 CDD:293791
WD40 repeat 1079..1114 CDD:293791
WD40 repeat 1120..1157 CDD:293791
WD40 repeat 1162..1196 CDD:293791
WD40 repeat 1201..1233 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I3151
eggNOG 1 0.900 - - E1_KOG1933
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.