DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11227 and CG12923

DIOPT Version :9

Sequence 1:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001260840.1 Gene:CG12923 / 36026 FlyBaseID:FBgn0033461 Length:323 Species:Drosophila melanogaster


Alignment Length:365 Identity:71/365 - (19%)
Similarity:143/365 - (39%) Gaps:70/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 DKLCLKKSISPIVKSDFEPLEPLRSDDSFTEAWMNSNFKRVQNQQDLRIGGLYRRGEKLKFQPID 471
            ||||                      |.|.|      :|:.:.:..|.:        |.|...:.
  Fly    12 DKLC----------------------DQFEE------YKKKREEAHLEL--------KNKVNTMF 40

  Fly   472 RLDAGWVGLPLFKDSEESLERTQYFVTEFDKLSHADKVQDIELRMSQLRWLHATSDHEYRQHFR- 535
            .|.|.      .|:..|::|..:..:.:.|........|...:..|....:.|....|.:...: 
  Fly    41 NLKAD------IKELNENMETLRIGMQQLDDQQKVQLHQGKLMSQSMFGTIEAAPPDEGQVPLKD 99

  Fly   536 KQRIPFKKVLTNSVQ----YACPLNNDECPAVMNDTLLAHFVSRHLDEPGKELR--EIFEGEQML 594
            :..||.|.::.:.|:    ..|....|      :..||.|::..|.::.....|  .:.:.|:.:
  Fly   100 EDTIPNKLLIKSEVKKCLFEGCQRRID------SQLLLLHYLCDHENKEASFQRFLPVVKHERAV 158

  Fly   595 MIFSPRAFQLAKTECISVLGYGG----VRNKPCTLPAVRFMLTPNSGLP-EAYDHFDGHLPLLVM 654
            :.|.|.:.:....:.:.:|.|..    :..:.|         .|.:..| ..:.|.|.|:||:|:
  Fly   159 LSFKPTSCKNPDNQVLGLLAYNAQQLLISQRQC---------EPYNSFPLNQHSHLDSHIPLVVL 214

  Fly   655 ICRNPMGTVEGRKERFEGLEDEDTLALWMVSRDLPCPIHVAMTVLSRRLDITRSSIMKVRGLHKS 719
            |.:....|.. |..|...........||:|:......::|.:::..|.:.:..|.::.||.::.:
  Fly   215 ISQTLPNTAL-RNRRSPDSHRNSEFVLWLVTPSDGLQLNVTLSLYGRDVALRTSCVLGVRKVNNN 278

  Fly   720 QDPLDFMLSNKNYMRLSNHDLRVLTNDHREPIYLEIVVKE 759
            :|...:|..:::|.||:..::..|:|:.|:.::||:||.|
  Fly   279 RDADYYMAVDESYWRLTYAEVEKLSNNFRDELHLEVVVTE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 41/209 (20%)
CG12923NP_001260840.1 DUF4729 115..313 CDD:292491 41/213 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.