DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11227 and boil

DIOPT Version :9

Sequence 1:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster


Alignment Length:281 Identity:68/281 - (24%)
Similarity:122/281 - (43%) Gaps:39/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 VTEFDKLSHADKVQ----DIELRMSQLRWLHATSDHEYRQHF--RKQRIPFKKVLTNSVQYACPL 555
            |....|.||:.|::    |:|.:          .::..|:|.  ...|.|.|.:|:|..|...|.
  Fly     3 VPRIKKRSHSRKIEATPMDVEEK----------DNNRDRKHILNHLSRAPGKCILSNCNQLVFPS 57

  Fly   556 NNDECPAVMNDTLLAHFVSRHLDEPGKELREIFEGEQMLMIFSPRAFQLAKTECISVLGYGGVRN 620
            |           :|.|.:.:|.:.|...|..|::.:::...|:..:.:..:.:.:::|.|.|...
  Fly    58 N-----------MLVHMLRKHNNSPNTNLAIIYDNQRLRKTFNLNSLKYDEPQVLNILLYAGTEG 111

  Fly   621 KPCTLPAVRFMLTPNSGLPEAYDHFDGHLPLLVMICRNPM-----GTVEGRK-ERFEGLEDEDTL 679
            ||.|.||.|::..||.|||.::..::.||.:.:|||:...     ..:.|.| |:..|..:....
  Fly   112 KPHTRPARRYLSYPNCGLPHSFGRYEHHLMMNLMICKTSWFSMLPDRICGEKLEKMHGTPENTIY 176

  Fly   680 ALWMVSRDLPCPIHVAMTVLSRRLDITRSSIMKVRGLHKSQDPLDFMLSNKNYMRLSNHDLRVLT 744
            .:|::..:....:...:|...|....:||.|.|.|....||.|.||:....:|:.|.:.:...|.
  Fly   177 VIWLMGPETSSRMFYTLTAYDRYYIQSRSVIRKTRNFFLSQQPKDFLNHENDYLMLRHEEAMDLM 241

  Fly   745 NDHREP------IYLEIVVKE 759
            |...:.      |.||:.:.|
  Fly   242 NGEGDELNQTSYIKLELFLHE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 50/214 (23%)
boilNP_572191.2 DUF4729 43..249 CDD:292491 53/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469460
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM22
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 1 1.000 - - otm50272
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.