DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11227 and CG12682

DIOPT Version :9

Sequence 1:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_572190.1 Gene:CG12682 / 31415 FlyBaseID:FBgn0029729 Length:237 Species:Drosophila melanogaster


Alignment Length:225 Identity:54/225 - (24%)
Similarity:105/225 - (46%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 CPLNNDECPAVMNDT-LLAHFVSRHLDEPGK------ELREIFEGEQMLMIFSPRAFQLAKTECI 610
            |||  .:|.||:..| ||.|.:::|||...:      .|||:..|::.|::...|...:...:|:
  Fly    20 CPL--ADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVSTGQRTLLMLPYRQLIIDNDQCL 82

  Fly   611 SVLGYGGVRNKPCTLPAVRFMLTPNSGLPEAYDHFDGHLPLLVMICRNPMGTVEGRKERFEGLED 675
            :||.:..|.....|.|.:        .||..:.....|||:|||:||....::..:.:..:..|.
  Fly    83 AVLNWSSVSQGDLTAPQL--------DLPPCHQMLTYHLPILVMVCRTTWKSLLKQIDEKDMQET 139

  Fly   676 EDTLA-------LWMVSRDLPCPIHVAMTVLSRRL-DITRSSIMKVRGLHKSQDPLDFMLSNKN- 731
            .|..|       .|::|.....||:..:.:|:.:: .:.|.:..::|.. .|:.|:...::..: 
  Fly   140 RDVTAEWGGVYLFWLLSPLTRRPIYANLALLNSQIQSVYRRNRRRIRNF-ASRMPIRQFINGLDP 203

  Fly   732 -YMRLSNHDLRVLTN--DHREPIYLEIVVK 758
             ::.::...|..|.|  .:|..||.|::::
  Fly   204 YFVSINEDQLDELCNGGGNRFSIYFEVIIE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 53/219 (24%)
CG12682NP_572190.1 DUF4729 20..222 CDD:292491 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.