DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11227 and CG15472

DIOPT Version :9

Sequence 1:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster


Alignment Length:284 Identity:66/284 - (23%)
Similarity:102/284 - (35%) Gaps:97/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 CPLNNDEC-PAVMNDTLLAHFVSRHL-DEPGKELREIFEGEQMLMIFSPRAFQLAKTECISVLGY 615
            ||:  ::| ..|..|.:|.|...||. ....|.|:..|.||:..::|........:|.|:.||.|
  Fly    35 CPI--EKCISTVFKDDMLQHLAQRHFRSNVKKHLQVAFNGERCTLVFDVSQLIGTQTICLGVLLY 97

  Fly   616 GGVRNKPCTLPAVRFM-----LTPNSGLPEAYDHFDGHLPLLVMICRNPM---GTVEGRKERFEG 672
            ||||.|...||..|..     |..:|||....|    :||::|::.|...   ..|:.:.|..|.
  Fly    98 GGVRGKHSQLPGEREFCYHNRLKEDSGLESLKD----YLPIMVLVKRTTFLCWALVDRKMESQED 158

  Fly   673 LE----------------------------------------------------DEDTLALWMVS 685
            |.                                                    |.|.|.:|  :
  Fly   159 LNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQEEIMDSDILIIW--T 221

  Fly   686 RDLPC--PIHVAMTVLSRRLDITRSSIMKVRGLHKSQDPLDFMLSNKNYMRL-------SNHDLR 741
            :..||  |:||||||.:..|.:.||::..|..            |.:.|..:       ..|.|.
  Fly   222 QSAPCIRPLHVAMTVFNSTLSVGRSAMRCVAN------------SGQMYTEIGGKDLPKDRHSLL 274

  Fly   742 VLTNDHRE------PIYLEIVVKE 759
            :...:.:|      .::||:::.|
  Fly   275 ITQQELKEICGAEHHLHLELILHE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 63/277 (23%)
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.