DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-3 and INH3

DIOPT Version :9

Sequence 1:NP_728367.3 Gene:I-3 / 33068 FlyBaseID:FBgn0261624 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_565720.1 Gene:INH3 / 817688 AraportID:AT2G31305 Length:107 Species:Arabidopsis thaliana


Alignment Length:96 Identity:28/96 - (29%)
Similarity:45/96 - (46%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SRASETFSGVGSAISTETSLQPVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCC 94
            |.|:...|...:::..|..:..........|||.:::    :.|.:..|.:|||.|.::.||.||
plant     2 STATRPSSSATTSVILENPVSQSQPTERLVLRLNRKK----KKVSWKDGTVDNEFMQKKSSKKCC 62

  Fly    95 IYRKPHPFGESSSSTDDE----CEHCFGHPE 121
            |:.|..||.|..|..:|:    |:|...|.|
plant    63 IFHKQKPFDEDDSEEEDDNNHHCDHNHEHSE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-3NP_728367.3 PPI_Ypi1 60..113 CDD:284827 20/56 (36%)
INH3NP_565720.1 PPI_Ypi1 31..>70 CDD:400048 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2544
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.