DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-3 and Ppp1r11

DIOPT Version :9

Sequence 1:NP_728367.3 Gene:I-3 / 33068 FlyBaseID:FBgn0261624 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_083908.1 Gene:Ppp1r11 / 76497 MGIID:1923747 Length:131 Species:Mus musculus


Alignment Length:131 Identity:41/131 - (31%)
Similarity:63/131 - (48%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SETFSGVGSAIS----TETSLQPVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCC 93
            :||.:|:...::    |||::.....|....|.:..::...|:.|.:.:..:|||||.||.||||
Mouse     2 AETGAGISETVTETTVTETTVTETTEPENQSLTMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCC 66

  Fly    94 CIYRKPHPFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLHSNRNNRPP 158
            |||.||..|||||:.:|                       ::::.|||   |.|.:..:|..|.|
Mouse    67 CIYEKPRAFGESSTESD-----------------------EDEEEGCS---HKHCVRGHRKGRRP 105

  Fly   159 T 159
            |
Mouse   106 T 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-3NP_728367.3 PPI_Ypi1 60..113 CDD:284827 25/52 (48%)
Ppp1r11NP_083908.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 41/131 (31%)
PPI_Ypi1 34..76 CDD:284827 18/41 (44%)
Atypical RING finger domain 1. /evidence=ECO:0000250|UniProtKB:O60927 57..67 7/9 (78%)
Atypical RING finger domain 2. /evidence=ECO:0000250|UniProtKB:O60927 90..99 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847606
Domainoid 1 1.000 66 1.000 Domainoid score I9905
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5132
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - otm44026
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.