DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-3 and Ppp1r11

DIOPT Version :9

Sequence 1:NP_728367.3 Gene:I-3 / 33068 FlyBaseID:FBgn0261624 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_997707.2 Gene:Ppp1r11 / 294207 RGDID:1303163 Length:127 Species:Rattus norvegicus


Alignment Length:127 Identity:40/127 - (31%)
Similarity:59/127 - (46%) Gaps:26/127 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SETFSGVGSAISTETSLQPVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYR 97
            :|..:|..|...|||::.....|....|.:..::...|:.|.:.:..:|||||.||.|||||||.
  Rat     2 AEAGAGGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYE 66

  Fly    98 KPHPFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLHSNRNNRPPT 159
            ||..|||||:.:|                       ::::.||.   |.|.:..:|..|.||
  Rat    67 KPRAFGESSTESD-----------------------EDEEEGCG---HTHCVRGHRKGRRPT 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-3NP_728367.3 PPI_Ypi1 60..113 CDD:284827 25/52 (48%)
Ppp1r11NP_997707.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 14/52 (27%)
PPI_Ypi1 30..72 CDD:284827 18/41 (44%)
Atypical RING finger domain 1. /evidence=ECO:0000250|UniProtKB:O60927 53..63 7/9 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..127 14/59 (24%)
Atypical RING finger domain 2. /evidence=ECO:0000250|UniProtKB:O60927 86..95 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351167
Domainoid 1 1.000 66 1.000 Domainoid score I9690
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599272at2759
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - otm46117
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.