DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-3 and ZK945.8

DIOPT Version :9

Sequence 1:NP_728367.3 Gene:I-3 / 33068 FlyBaseID:FBgn0261624 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_496183.1 Gene:ZK945.8 / 191472 WormBaseID:WBGene00014170 Length:109 Species:Caenorhabditis elegans


Alignment Length:97 Identity:39/97 - (40%)
Similarity:49/97 - (50%) Gaps:21/97 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYRKPHPFGESSS--STDDECEHCFGH--P 120
            |||  :.|:....|.:.|||||||||.|.||.|||||..|..:.:.|:  ..:.|.|||.||  |
 Worm    21 LRL--RAPVERPRVTWGAGVIDNEHMGRLKSNCCCIYTPPRVWDDPSTWEPEEHETEHCRGHTLP 83

  Fly   121 EVRTRNRLEKQRIQ--------EQQNGCSCCH 144
            |       :||:.|        |.:..|.|.|
 Worm    84 E-------KKQKPQGGHGSDKDEDKGNCGCDH 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-3NP_728367.3 PPI_Ypi1 60..113 CDD:284827 24/54 (44%)
ZK945.8NP_496183.1 PPI_Ypi1 20..72 CDD:284827 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 1 1.000 - - mtm4825
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.