DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-3 and C07H6.2

DIOPT Version :9

Sequence 1:NP_728367.3 Gene:I-3 / 33068 FlyBaseID:FBgn0261624 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_498652.1 Gene:C07H6.2 / 182382 WormBaseID:WBGene00015579 Length:107 Species:Caenorhabditis elegans


Alignment Length:95 Identity:38/95 - (40%)
Similarity:49/95 - (51%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SETFSGVGSAISTETSLQPVAAPTMYCLRL----AQQRPITERHVHFHAGVIDNEHMNRRKSKCC 93
            |.|.....|:..|.|...|.:......|.|    ||......|||.:....:|||.|.::|||||
 Worm     2 SHTQQQTASSTETSTVTVPPSREQNLVLHLSPNPAQPSTSERRHVVWATETVDNEGMGKKKSKCC 66

  Fly    94 CIYRKPHPFGESSSSTDDECE--HCFGHPE 121
            |||:||..:.:|||.:|.:||  ||.||.|
 Worm    67 CIYKKPKNWQDSSSDSDSDCETGHCRGHVE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-3NP_728367.3 PPI_Ypi1 60..113 CDD:284827 25/56 (45%)
C07H6.2NP_498652.1 PPI_Ypi1 28..>75 CDD:284827 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165394
Domainoid 1 1.000 52 1.000 Domainoid score I7733
eggNOG 1 0.900 - - E1_KOG4102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3938
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104011
Panther 1 1.100 - - O PTHR20835
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1995
SonicParanoid 1 1.000 - - X3525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.