DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1314 and CG15482

DIOPT Version :9

Sequence 1:NP_608411.2 Gene:CG1314 / 33066 FlyBaseID:FBgn0031134 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster


Alignment Length:284 Identity:63/284 - (22%)
Similarity:100/284 - (35%) Gaps:70/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RLENENDGNDTDEEVEICFTSLMPDHRRRLYMDCKLSLPAGGRVPMRGGAEAISASPHGRISSPE 117
            |...|.......|..::.:|....::|          |||....|          :|..::....
  Fly    29 RKRQERRKQRLQEMQDLLYTKHFSNYR----------LPASVAAP----------APEDQLLLKL 73

  Fly   118 IRYERLRNTAVEVRKY---------WRLQKLDMACPLSNCDLMFNPEQLLSHCLMHH-----EHI 168
            ..:|.|.......||.         |...:| :|||...|....:|..||.|.|..|     ...
  Fly    74 QNFESLTEQPSSSRKSTATTSSDSPWSRLRL-VACPCHGCLCSVDPSALLGHYLSDHLPGMGVPF 137

  Fly   169 ITMEMKPKEPKVLKLCGKSLPEDRGKSNCVGLMIY-ESGNN---ATRNLNLPNIYKDWECQLPVL 229
            ..:||   ..:|...|..|..| |..:..:|:..| .:|.|   ..||.:||..|:.:.....::
  Fly   138 YELEM---GKRVSLTCHISSLE-RDVNTLLGVYGYRRTGLNPLKCHRNTHLPVEYRRFSQHSALM 198

  Fly   230 IMLWKTSWDSMPVGPRVTH-IYILWLCCPQAQTPL---LVSVNIGENTPGVPR--------RQMI 282
            |...:|....:....||.| :..:|:.     |||   .:::.:......:||        |.|:
  Fly   199 IFACRTMHSVLWERKRVKHEVLAIWVA-----TPLHGVAITLRLLVQPANLPRYYTRQIKARPML 258

  Fly   283 -----QTCQGSETLK---NCDLLS 298
                 |:|  ||.:|   |..|:|
  Fly   259 PLSSNQSC--SEFIKTDSNVILIS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1314NP_608411.2 DUF4729 142..319 CDD:292491 47/186 (25%)
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 47/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.