DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1314 and CG11227

DIOPT Version :9

Sequence 1:NP_608411.2 Gene:CG1314 / 33066 FlyBaseID:FBgn0031134 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster


Alignment Length:268 Identity:51/268 - (19%)
Similarity:102/268 - (38%) Gaps:65/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RISSPEIRYERLR----NTAVEVRKYWRLQKL----------DMACPLSN--CDLMFNPEQLLSH 160
            ::...|:|..:||    .:..|.|:::|.|::          ..||||:|  |..:.| :.||:|
  Fly   508 KVQDIELRMSQLRWLHATSDHEYRQHFRKQRIPFKKVLTNSVQYACPLNNDECPAVMN-DTLLAH 571

  Fly   161 CLMHHEHIITMEMKPKEPKVLKLCGKSLPE----------------DRGKSNCVGLMIYESGNN- 208
            .:..|         ..||      ||.|.|                ...|:.|:.::.|....| 
  Fly   572 FVSRH---------LDEP------GKELREIFEGEQMLMIFSPRAFQLAKTECISVLGYGGVRNK 621

  Fly   209 ----------ATRNLNLPNIYKDWECQLPVLIMLWKTSWDSMP------VGPRVTHIYILWLCCP 257
                      .|.|..||..|..::..||:|:|:.:....::.      .|........||:...
  Fly   622 PCTLPAVRFMLTPNSGLPEAYDHFDGHLPLLVMICRNPMGTVEGRKERFEGLEDEDTLALWMVSR 686

  Fly   258 QAQTPLLVSVNIGENTPGVPRRQMIQTCQGSETLKNCDLLSDSPHFMRFTHREMKEHTEDYTLDV 322
            ....|:.|::.:......:.|..:::.....::....|.:..:.::||.::.:::..|.|:...:
  Fly   687 DLPCPIHVAMTVLSRRLDITRSSIMKVRGLHKSQDPLDFMLSNKNYMRLSNHDLRVLTNDHREPI 751

  Fly   323 DLQFTILE 330
            .|:..:.|
  Fly   752 YLEIVVKE 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1314NP_608411.2 DUF4729 142..319 CDD:292491 41/211 (19%)
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 41/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.