DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1314 and CG12682

DIOPT Version :9

Sequence 1:NP_608411.2 Gene:CG1314 / 33066 FlyBaseID:FBgn0031134 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_572190.1 Gene:CG12682 / 31415 FlyBaseID:FBgn0029729 Length:237 Species:Drosophila melanogaster


Alignment Length:150 Identity:32/150 - (21%)
Similarity:63/150 - (42%) Gaps:27/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 CPLSNCDLMFNPEQLLSHCLMHH----EHIITMEMKPKEPK-----VLKLCGKSLPEDRGKSNCV 198
            |||::|..:.....||.|.:..|    ...:..:::.:|..     :|.|..:.|..|  ...|:
  Fly    20 CPLADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVSTGQRTLLMLPYRQLIID--NDQCL 82

  Fly   199 GLMIYES---GNNATRNLNLPNIYKDWECQLPVLIMLWKTSWDSM-------------PVGPRVT 247
            .::.:.|   |:.....|:||..::.....||:|:|:.:|:|.|:             .|.....
  Fly    83 AVLNWSSVSQGDLTAPQLDLPPCHQMLTYHLPILVMVCRTTWKSLLKQIDEKDMQETRDVTAEWG 147

  Fly   248 HIYILWLCCPQAQTPLLVSV 267
            .:|:.||..|..:.|:..::
  Fly   148 GVYLFWLLSPLTRRPIYANL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1314NP_608411.2 DUF4729 142..319 CDD:292491 32/149 (21%)
CG12682NP_572190.1 DUF4729 20..222 CDD:292491 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.