DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LPGAT1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001362773.1 Gene:LPGAT1 / 9926 HGNCID:28985 Length:403 Species:Homo sapiens


Alignment Length:269 Identity:55/269 - (20%)
Similarity:84/269 - (31%) Gaps:110/269 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VTQRFVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTV---WLLGWVVRYGLLLPFRTIGCWLCLFM 162
            |....||.||... :.::.:.||..:....|.:..:   ||||.|..:|          |...:.
Human    59 VVNNLVAIPSYIC-YVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWG----------WYAGYT 112

  Fly   163 -------ISGVS-----MLLGH--IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTK 213
                   |..||     ||:.|  ..|.|        .|..|.:                   .|
Human   113 VMEWGEDIKAVSKDEAVMLVNHQATGDVC--------TLMMCLQ-------------------DK 150

  Fly   214 GICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLR 278
            |:.|..       ::.:.|..:..|   :.||:.::        |..:|.|:..:.|:...|:|:
Human   151 GLVVAQ-------MMWLMDHIFKYT---NFGIVSLV--------HGDFFIRQGRSYRDQQLLLLK 197

  Fly   279 LHCS----MKDRPPVLLFPEG---------------------------------TCINNTAVMQF 306
            .|..    .:||..::|||||                                 ..|.|..|.|.
Human   198 KHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQ 262

  Fly   307 KKGSFAVSD 315
            |.||.|..|
Human   263 KNGSPAGGD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 30/162 (19%)
LPGAT1NP_001362773.1 LPLAT_LCLAT1-like 102..318 CDD:153252 43/225 (19%)
Acyltransf_C 307..376 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.