Sequence 1: | NP_608409.1 | Gene: | CG15450 / 33064 | FlyBaseID: | FBgn0031132 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362773.1 | Gene: | LPGAT1 / 9926 | HGNCID: | 28985 | Length: | 403 | Species: | Homo sapiens |
Alignment Length: | 269 | Identity: | 55/269 - (20%) |
---|---|---|---|
Similarity: | 84/269 - (31%) | Gaps: | 110/269 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 VTQRFVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTV---WLLGWVVRYGLLLPFRTIGCWLCLFM 162
Fly 163 -------ISGVS-----MLLGH--IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTK 213
Fly 214 GICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLR 278
Fly 279 LHCS----MKDRPPVLLFPEG---------------------------------TCINNTAVMQF 306
Fly 307 KKGSFAVSD 315 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15450 | NP_608409.1 | LPLAT_LPCAT1-like | 191..399 | CDD:153253 | 30/162 (19%) |
LPGAT1 | NP_001362773.1 | LPLAT_LCLAT1-like | 102..318 | CDD:153252 | 43/225 (19%) |
Acyltransf_C | 307..376 | CDD:374349 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |