DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LOA1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_015465.1 Gene:LOA1 / 856261 SGDID:S000006343 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:48/237 - (20%)
Similarity:85/237 - (35%) Gaps:88/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RYLSWR-------------------LRTVWLLGWV-VRYGLLLPFRTIGCWLCLFMISGVSMLLG 171
            :|.:||                   :.|..|||.: |:..::||.      :.|::::|.:.|||
Yeast     3 KYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPL------IMLYLLTGQNNLLG 61

  Fly   172 HIPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKG-ICVCNHTSPLDV--LVLMCDA 233
            .|..:.|..| .|:.::...:         |....:::.|.|| :.:||.|||||.  :||:...
Yeast    62 LILKFTFSWK-EEITVQGIKK---------RDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQG 116

  Fly   234 ---------------------NYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVL 277
                                 |:.|.|.:...:.|                 .|:|:...||..:
Yeast   117 PVTLLVPSNDIVYKVSIREFINFILAGGLDIKLYG-----------------HEVAELSQLGNTV 164

  Fly   278 RLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVSDVVHP 319
            .           .:|.|||..|..:|:.|......:.:.:.|
Yeast   165 N-----------FMFAEGTSCNGKSVLPFSITGKKLKEFIDP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 29/153 (19%)
LOA1NP_015465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.