DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and SCT1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_009542.1 Gene:SCT1 / 852271 SGDID:S000000107 Length:759 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:15/73 - (20%)
Similarity:28/73 - (38%) Gaps:19/73 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 QVHTGIL-GVLQRALSRVSHHMWFDR--KELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNT 301
            ::.|.:| |...:..::|.....:.|  :.||....:|                :||||...:.|
Yeast   211 EIKTALLTGTTYKYAAKVDQSCVYHRVFEHLAHNNCIG----------------IFPEGGSHDRT 259

  Fly   302 AVMQFKKG 309
            .::..|.|
Yeast   260 NLLPLKAG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 15/73 (21%)
SCT1NP_009542.1 LPLAT_AAK14816-like 56..343 CDD:153254 15/73 (21%)
MASE4 <441..548 CDD:319176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.