powered by:
Protein Alignment CG15450 and SCT1
DIOPT Version :9
Sequence 1: | NP_608409.1 |
Gene: | CG15450 / 33064 |
FlyBaseID: | FBgn0031132 |
Length: | 407 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009542.1 |
Gene: | SCT1 / 852271 |
SGDID: | S000000107 |
Length: | 759 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 15/73 - (20%) |
Similarity: | 28/73 - (38%) |
Gaps: | 19/73 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 QVHTGIL-GVLQRALSRVSHHMWFDR--KELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNT 301
::.|.:| |...:..::|.....:.| :.||....:| :||||...:.|
Yeast 211 EIKTALLTGTTYKYAAKVDQSCVYHRVFEHLAHNNCIG----------------IFPEGGSHDRT 259
Fly 302 AVMQFKKG 309
.::..|.|
Yeast 260 NLLPLKAG 267
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0204 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.