DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and YDR018C

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_010301.1 Gene:YDR018C / 851581 SGDID:S000002425 Length:396 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:40/219 - (18%)
Similarity:72/219 - (32%) Gaps:80/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 RQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLMCDANYS-LTGQVHTGILGVLQR 251
            :.|||.                 ..:.|.:.||....|.:.|...:..| |.|.|:.    :|::
Yeast   102 KPCFRF-----------------KDRAIIIANHQMYADWIYLWWLSFVSNLGGNVYI----ILKK 145

  Fly   252 ALS---------RVSHHMWFDRKELADREAL-GLVLRLHCSMKDRPP------------------ 288
            ||.         |....::..|....|.:|| ..::.:..:.:.:.|                  
Yeast   146 ALQYIPLLGFGMRNFKFIFLSRNWQKDEKALTNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAY 210

  Fly   289 -VLLFPEGTCIN---------------------NTAVMQFKKG-SFAVS------DVVHPVAIRY 324
             :::|||||.::                     ...::...|| .|||.      |.::.|.|.|
Yeast   211 NLIMFPEGTNLSLKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKFAVEKLAPSLDAIYDVTIGY 275

  Fly   325 DRRFGEAYWDSTRYSMLRYMLMVV 348
            .......| ..|::::.:..||.|
Yeast   276 SPALRTEY-VGTKFTLKKIFLMGV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 39/216 (18%)
YDR018CNP_010301.1 LPLAT_LCLAT1-like 102..308 CDD:153252 40/219 (18%)
Acyltransf_C 300..>347 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.