Sequence 1: | NP_608409.1 | Gene: | CG15450 / 33064 | FlyBaseID: | FBgn0031132 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010301.1 | Gene: | YDR018C / 851581 | SGDID: | S000002425 | Length: | 396 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 219 | Identity: | 40/219 - (18%) |
---|---|---|---|
Similarity: | 72/219 - (32%) | Gaps: | 80/219 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 188 RQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLMCDANYS-LTGQVHTGILGVLQR 251
Fly 252 ALS---------RVSHHMWFDRKELADREAL-GLVLRLHCSMKDRPP------------------ 288
Fly 289 -VLLFPEGTCIN---------------------NTAVMQFKKG-SFAVS------DVVHPVAIRY 324
Fly 325 DRRFGEAYWDSTRYSMLRYMLMVV 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15450 | NP_608409.1 | LPLAT_LPCAT1-like | 191..399 | CDD:153253 | 39/216 (18%) |
YDR018C | NP_010301.1 | LPLAT_LCLAT1-like | 102..308 | CDD:153252 | 40/219 (18%) |
Acyltransf_C | 300..>347 | CDD:406475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |