DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LPAT3

DIOPT Version :10

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_175537.1 Gene:LPAT3 / 841549 AraportID:AT1G51260 Length:376 Species:Arabidopsis thaliana


Alignment Length:50 Identity:13/50 - (26%)
Similarity:23/50 - (46%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QGKWCV---KAFYVSGNHSVAEAK-CNENSATLTGFQTSDERMKTARNKT 132
            |..|..   :.|.:|....:.:.| .|.|.:.|.|..|:| |.:..|:::
plant   120 QDPWSFAVSQRFALSSQLPLQDVKYANLNGSGLLGLLTND-RFQFLRSES 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253
LPAT3NP_175537.1 PLN02380 1..376 CDD:178006 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.