DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and PES2

DIOPT Version :10

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_566801.1 Gene:PES2 / 822299 AraportID:AT3G26840 Length:701 Species:Arabidopsis thaliana


Alignment Length:111 Identity:25/111 - (22%)
Similarity:40/111 - (36%) Gaps:37/111 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 VLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLV----LRLHCSMKDR 286
            |:.||.:.|..|.|..|..:...||.:|        .|.|.....:.:|.|    ..::..::::
plant   462 VIQLMTERNIHLRGLAHPMLFKNLQDSL--------VDTKMFDKYKIMGGVPVSHFNIYKLLREK 518

  Fly   287 PPVLLFPEGTCINNTAVMQFKKGSFAVSDVVHPVAIRYDRRFGEAY 332
            ..|||:|.|                 |.:.:|        |.||.|
plant   519 AHVLLYPGG-----------------VREALH--------RKGEEY 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 25/111 (23%)
PES2NP_566801.1 alpha/beta hydrolases 121..371 CDD:473884
LPLAT_MGAT-like 430..666 CDD:153249 25/111 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.