DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and AT3G26820

DIOPT Version :10

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_189317.1 Gene:AT3G26820 / 822297 AraportID:AT3G26820 Length:634 Species:Arabidopsis thaliana


Alignment Length:224 Identity:49/224 - (21%)
Similarity:80/224 - (35%) Gaps:77/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RTVWLLGW--VVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAA 196
            |..|||..  :|||...||    .|.:.....:|...||....|      |..::...||     
plant   300 RDQWLLNEEDIVRYSRTLP----NCIVRKLDDNGQFPLLEDSLD------LATIIKLTCF----- 349

  Fly   197 CLPMIRRFHNTEY-----RPT---------KGICVCNHTSP-----LDVLVLMCDANYSLTGQVH 242
                .||..:.:|     :||         :...:.:..||     |:..:|:.:.|..:.|..|
plant   350 ----YRRGKSHDYVSDYIKPTPFELQQLLDEHRLLMDAISPVMLSTLEDGLLLKERNIHMRGLTH 410

  Fly   243 TGILGVLQRALSRVSHHMWFDRKELADREALGLV----LRLHCSMKDRPPVLLFPEGTCINNTAV 303
            ..:...:|.:|  |...| ||:.:|     :|.|    :..:..::::..|||:|.|        
plant   411 PMVFMYIQDSL--VDPKM-FDKYKL-----MGGVPVSNMNFYKLLREKAHVLLYPGG-------- 459

  Fly   304 MQFKKGSFAVSDVVHPVAIRYDRRFGEAY 332
                     |.:.:|        |.||.|
plant   460 ---------VREALH--------RKGEEY 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 33/165 (20%)
AT3G26820NP_189317.1 alpha/beta hydrolases 88..336 CDD:473884 13/39 (33%)
YvaK <150..>207 CDD:441253
LPLAT_MGAT-like 397..599 CDD:153249 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.