DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and agpat2

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001071200.1 Gene:agpat2 / 777624 ZFINID:ZDB-GENE-061103-541 Length:271 Species:Danio rerio


Alignment Length:212 Identity:48/212 - (22%)
Similarity:79/212 - (37%) Gaps:63/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VWLLGWVVRYGLLL------PFRTIGCWLCLFMISGVSMLLG--HIPDWCFKKKLVEL----VLR 188
            ||:|..::...|||      .|....|:...:|     |||.  .||....|....::    |:|
Zfish     4 VWMLPVLLVLPLLLWTSSTFVFYFKKCFYVAYM-----MLLAVIAIPICILKSGGRDIENMRVIR 63

  Fly   189 QCFRITAACLPMIRRFHNTEYRPTKG--ICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQR 251
            ...|.....|.:..:....|:..|:|  :.:.||.|.||||                |::.:|..
Zfish    64 FLVRHVKYFLGLRYQVSGWEHLQTEGPYVIISNHQSSLDVL----------------GMVEILPD 112

  Fly   252 ALSRVSHHMWFDRKELADREALGLVLRL----------------------HCSMKDRPPVLLFPE 294
            ..:.::      :|||.....:|::..|                      ...:.|:..:.:|||
Zfish   113 RCTMIA------KKELIWAGTVGMICWLGGIVFINRKKTSDAKNVMSDAAKTMLTDKIRLWVFPE 171

  Fly   295 GTCINNTAVMQFKKGSF 311
            ||...|..::.||||:|
Zfish   172 GTRNQNGGLLPFKKGAF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 31/145 (21%)
agpat2NP_001071200.1 PlsC 31..265 CDD:223282 40/185 (22%)
LPLAT_AGPAT-like 66..246 CDD:153251 31/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.