DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Tmem68

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_082373.1 Gene:Tmem68 / 72098 MGIID:1919348 Length:329 Species:Mus musculus


Alignment Length:93 Identity:22/93 - (23%)
Similarity:42/93 - (45%) Gaps:28/93 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 EWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCF 178
            ||    ..:.|...||::....:|:...::.  |:||:.||      |::. ::::..||    :
Mouse    27 EW----LGVEQLEDYLNFANHLLWVFTPLIL--LILPYFTI------FLLY-LTIIFLHI----Y 74

  Fly   179 KKKLVELVLRQCF--------RITAACL 198
            |:|   .||::.:        |.|.|.|
Mouse    75 KRK---NVLKEAYSHNLWDGARKTVATL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 4/16 (25%)
Tmem68NP_082373.1 PlsC 58..303 CDD:223282 13/56 (23%)
LPLAT_MGAT-like 103..309 CDD:153249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.