DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat4

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006523408.3 Gene:Agpat4 / 68262 MGIID:1915512 Length:458 Species:Mus musculus


Alignment Length:259 Identity:61/259 - (23%)
Similarity:104/259 - (40%) Gaps:75/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 WLC------LFMISGV---SMLLGHIPDWCFKKKLVELV-LRQCFRITAACLPMIRRFHNTE--- 208
            :||      :|:.||:   ::.|..:..|...|:|...: .|.|:.:::..:.::..:..||   
Mouse    91 FLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTI 155

  Fly   209 ---------YRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILG---VLQR---ALSRVSH 258
                     |.....|.|.||...:|.|     ..:||..::  ||||   ||.:   |...:..
Mouse   156 YTDPKACPHYGKENAIVVLNHKFEIDFL-----CGWSLAERL--GILGNSKVLAKKELAYVPIIG 213

  Fly   259 HMWF-------DRKELADREALGLVLRLHCSMKDRPPVLLF---PEGTCINNTAVMQFKKGSFAV 313
            .||:       .||...||:.:...| ||  ::|.|...||   .|||....      ||     
Mouse   214 WMWYFVEMIFCTRKWEQDRQTVAKSL-LH--LRDYPEKYLFLIHCEGTRFTE------KK----- 264

  Fly   314 SDVVHPVAIRYDRRFGEAYWDSTRYSML-RYMLMVVSSWCICCDVWYMPALSRC-----NDESP 371
                |.::::..:..|   ..|.::.:| |.....::..|: .||  :||:..|     |:|:|
Mouse   265 ----HQISMQVAQAKG---LPSLKHHLLPRTKGFAITVKCL-RDV--VPAVYDCTLNFRNNENP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 50/215 (23%)
Agpat4XP_006523408.3 PLN02380 100..406 CDD:178006 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.