DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Aup1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001073368.1 Gene:Aup1 / 680423 RGDID:1591777 Length:410 Species:Rattus norvegicus


Alignment Length:257 Identity:61/257 - (23%)
Similarity:106/257 - (41%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LLPFRTIG-CWLCLFMISGVSMLLGH--IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEY 209
            ||.:..:| |.|.|.:..|:.:.|..  :||...::.:|        |...|.|.::.|..::..
  Rat    28 LLLYAPVGLCLLVLRLFLGLHVFLVSCALPDSVLRRFVV--------RTMCAVLGLVARQEDSGL 84

  Fly   210 RPTK-GICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMW------FDRK-E 266
            |..: .:.:.||.:|.|..::      :|.....|.:|.      |..|...|      .||: |
  Rat    85 RDHRVRVLISNHVTPFDHNIV------NLLTTCSTPLLN------SPPSFVCWSRGFMEMDRRVE 137

  Fly   267 LADREALGLVLRLHCSMKDRP--PVLLFPEGTCIN-NTAVMQFKKGSFAVSDVVHPVAIRYDR-- 326
            |.:.      |:..|:....|  |:|||||....| ...:::|....|::.|||.|:.::..|  
  Rat   138 LVES------LKKFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPL 196

  Fly   327 ---RFGEAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDESPVEFSNRVKAAIAAQ 385
               ...:|.|    .|.|.:.|.|  .:.:....|..|...:..:|:. ||:.||:..:|.:
  Rat   197 VSVTVSDASW----VSELLWSLFV--PFTVYQVRWLHPIRRQLGEENE-EFALRVQQLVAKE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 50/211 (24%)
Aup1NP_001073368.1 LPLAT 66..264 CDD:302626 51/219 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..293
CUE_AUP1 300..340 CDD:270603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.