DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Lpgat1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038947017.1 Gene:Lpgat1 / 679692 RGDID:1585897 Length:407 Species:Rattus norvegicus


Alignment Length:203 Identity:41/203 - (20%)
Similarity:72/203 - (35%) Gaps:71/203 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 WLLGWVV-----RYGLLLPFRTIG-----CWLCL------------FMISGV--SMLLGHIPDWC 177
            | |||:|     |:..::....:.     |::.:            :.|.|:  ..|||.:..|.
  Rat    47 W-LGWIVAKALMRFAFMVANNLVAIPSYICYIIILQPLRVLDSKRFWYIEGLMYKWLLGMVASWG 110

  Fly   178 FKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVL-MC---------- 231
            :......:...:..:..|               ..:.:.:.||.:..||..| ||          
  Rat   111 WYAGYTVMEWGEDIKAIA---------------KDEAVMLVNHQATGDVCTLMMCLQDKGPVVAQ 160

  Fly   232 -----DANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCS----MKDRP 287
                 |..:..|   :.||:.::        |..:|.|:..|.|:...|||:.|..    .:||.
  Rat   161 MMWLMDHIFKYT---NFGIVSLI--------HGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRK 214

  Fly   288 PVLLFPEG 295
            .::|||||
  Rat   215 WIVLFPEG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 28/125 (22%)
Lpgat1XP_038947017.1 LPLAT_LCLAT1-like 106..322 CDD:153252 29/143 (20%)
Acyltransf_C 311..>366 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.