DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and AGPAT3

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_011527964.1 Gene:AGPAT3 / 56894 HGNCID:326 Length:463 Species:Homo sapiens


Alignment Length:295 Identity:62/295 - (21%)
Similarity:92/295 - (31%) Gaps:107/295 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CRLG------KKWAVGNKG-DGMEKLLSPPIKNRLNIRVEQCCDFITAGLGLVLEDDVTQRFVAP 108
            |.||      :|...|..| |.|...:..|::                      :|...||....
Human    39 CALGAVPGPSQKHRAGPAGPDAMGFCVCEPLE----------------------KDGCPQRGAVH 81

  Fly   109 PSPAGEWNLLTRNLRQRNRYLSWRLRTVWLLGWV-VRYGLLLPF----------------RTIGC 156
            |..:....||.        :|..:.....|:|:| |..||::.|                |.:.|
Human    82 PLLSSAMGLLA--------FLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNC 138

  Fly   157 WLCLFMISGVSMLLGHIPDW--CFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKGICVCN 219
            .|...:.|.:.|||    :|  |          .:|...|...  .:.||....     .:.:.|
Human   139 RLAYSLWSQLVMLL----EWWSC----------TECTLFTDQA--TVERFGKEH-----AVIILN 182

  Fly   220 HTSPLDVLV--LMCDANYSLTGQVHTGILG----VLQRALSRVSHHMW---------FDRKELAD 269
            |...:|.|.  .||:         ..|:||    :.::.|..|....|         ..||...|
Human   183 HNFEIDFLCGWTMCE---------RFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEED 238

  Fly   270 REALGLVLRLHCSMKDRPP---VLLFPEGTCINNT 301
            |:.:...||   .:.|.|.   .||:.|||....|
Human   239 RDTVVEGLR---RLSDYPEYMWFLLYCEGTRFTET 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 29/129 (22%)
AGPAT3XP_011527964.1 PLN02380 104..412 CDD:178006 45/200 (23%)
LPLAT_LCLAT1-like 149..343 CDD:153252 35/155 (23%)
Acyltransf_C 330..401 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.