DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and lpgat1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001025129.1 Gene:lpgat1 / 561832 ZFINID:ZDB-GENE-030131-2906 Length:371 Species:Danio rerio


Alignment Length:173 Identity:38/173 - (21%)
Similarity:62/173 - (35%) Gaps:53/173 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 WCFKKKLVE---LVLRQCFRITAACLPMI----------RRFHNTE---YR------PTKGICV- 217
            |...|.|:.   :.:..|..|.:.||.:|          :.|...|   :|      .:.|.|. 
Zfish    13 WILIKSLLRFTFMFVNNCVAIPSYCLYLIVLQPLRVLDAQTFWYIEGVMFRWLLAMVASWGWCAG 77

  Fly   218 ------CNHTSPLDVLVLMCDANYSLTGQVHTGIL-----GVLQRALSRVSHHM----------- 260
                  .:..||:.....|...|:..||.|.|.::     |.:.|.:..:..|:           
Zfish    78 YTVTEWGDDVSPMTEDEAMVIVNHQATGDVCTLMMCLQDKGTVVRKMMWLMDHVFKYTNFGVVSL 142

  Fly   261 ----WFDRKELADREALGLVLRLHCS----MKDRPPVLLFPEG 295
                :|.|:..|.||...:.|:.|..    .:||..::|||||
Zfish   143 IHGDFFIRQGKAHREKQLVYLKDHLDKFYYSRDRKWIVLFPEG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 34/155 (22%)
lpgat1NP_001025129.1 LPLAT_LCLAT1-like 69..286 CDD:153252 27/117 (23%)
Acyltransf_C 275..>331 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.