DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001156851.1 Gene:Agpat1 / 55979 MGIID:1932075 Length:285 Species:Mus musculus


Alignment Length:268 Identity:56/268 - (20%)
Similarity:102/268 - (38%) Gaps:88/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKK-------KLVELVL--- 187
            |.|:|......:|...:.|  ...|:....|..:.:        |..:       |::.|:|   
Mouse    19 LSTLWFCSSSAKYFFKMAF--YNGWILFLAILAIPV--------CAVRGRNVENMKILRLLLLHV 73

  Fly   188 RQCFRITAACLPMIRRFHNTEYRPTKG-ICVCNHTSPLDVLVLM------C------DANYSLTG 239
            :..:.|...    :|..|:  :.||:. :.|.||.|.||:|.:|      |      :..::.:.
Mouse    74 KYLYGIRVE----VRGAHH--FPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAKRELLWAGSA 132

  Fly   240 QVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRP-PVLLFPEGTCINNTAV 303
            .:...:.|::           :.|||...|  |:.::..:..::..:. .|.:|||||..:|.::
Mouse   133 GLACWLAGII-----------FIDRKRTGD--AISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSM 184

  Fly   304 MQFKKGSF--AVSDVVHPVAI----------RYDRRFGE-----------------------AYW 333
            :.||:|:|  ||...|..:.|          :.:|||..                       |..
Mouse   185 LPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALA 249

  Fly   334 DSTRYSML 341
            ||.|:|||
Mouse   250 DSVRHSML 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 45/200 (23%)
Agpat1NP_001156851.1 LPLAT_AGPAT-like 66..253 CDD:153251 43/205 (21%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 101..106 2/4 (50%)
EGTR motif. /evidence=ECO:0000250|UniProtKB:Q99943 175..178 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.