Sequence 1: | NP_608409.1 | Gene: | CG15450 / 33064 | FlyBaseID: | FBgn0031132 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001156851.1 | Gene: | Agpat1 / 55979 | MGIID: | 1932075 | Length: | 285 | Species: | Mus musculus |
Alignment Length: | 268 | Identity: | 56/268 - (20%) |
---|---|---|---|
Similarity: | 102/268 - (38%) | Gaps: | 88/268 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 LRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKK-------KLVELVL--- 187
Fly 188 RQCFRITAACLPMIRRFHNTEYRPTKG-ICVCNHTSPLDVLVLM------C------DANYSLTG 239
Fly 240 QVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRP-PVLLFPEGTCINNTAV 303
Fly 304 MQFKKGSF--AVSDVVHPVAI----------RYDRRFGE-----------------------AYW 333
Fly 334 DSTRYSML 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15450 | NP_608409.1 | LPLAT_LPCAT1-like | 191..399 | CDD:153253 | 45/200 (23%) |
Agpat1 | NP_001156851.1 | LPLAT_AGPAT-like | 66..253 | CDD:153251 | 43/205 (21%) |
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 | 101..106 | 2/4 (50%) | |||
EGTR motif. /evidence=ECO:0000250|UniProtKB:Q99943 | 175..178 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |