DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and AGPAT5

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_060831.2 Gene:AGPAT5 / 55326 HGNCID:20886 Length:364 Species:Homo sapiens


Alignment Length:277 Identity:55/277 - (19%)
Similarity:92/277 - (33%) Gaps:127/277 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RYLSWRLRTVWLLG----WVVRYGLLLPFRTIGCWL-------------CLFM---------ISG 165
            |||   |.:|.|||    :|:.:|:   :|.:..:|             |::.         .:|
Human    13 RYL---LPSVVLLGTAPTYVLAWGV---WRLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTG 71

  Fly   166 VSMLL-GHIPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVL 229
            |.:|| |.:|    |.|                       .|..|       :.||.|.:|.:| 
Human    72 VQILLYGDLP----KNK-----------------------ENIIY-------LANHQSTVDWIV- 101

  Fly   230 MCDANYSLTGQVHTGILGVLQRALSRVSHHM-----W---------------------FDRKELA 268
                         ..||.:.|.||..|.:.:     |                     |:.||:.
Human   102 -------------ADILAIRQNALGHVRYVLKEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMR 153

  Fly   269 DREALGLVLRLHCSMKDRPPVLLFPEGTCIN--NTAVMQ------FKKGSFAVSDVVHP------ 319
            ::      |:.:........:::|||||..|  .|.|:.      .::|...:..|:.|      
Human   154 NK------LQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATH 212

  Fly   320 VAIRYDRRFGEAYWDST 336
            ||....:.:.:|.:|.|
Human   213 VAFDCMKNYLDAIYDVT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 34/186 (18%)
AGPAT5NP_060831.2 PlsC 34..281 CDD:223282 45/253 (18%)
LPLAT_LCLAT1-like 63..263 CDD:153252 42/221 (19%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 93..98 2/4 (50%)
Acyltransf_C 258..318 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.